DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and lgals1.3

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001135709.1 Gene:lgals1.3 / 100216286 XenbaseID:XB-GENE-5849758 Length:135 Species:Xenopus tropicalis


Alignment Length:132 Identity:34/132 - (25%)
Similarity:47/132 - (35%) Gaps:25/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNAD-------IGLRFSCYFRNDVIVRN 65
            |||  |..||.:||..:.:....||         .||..||       ...||......:.|:.|
 Frog    11 NLS--LHKGHRVEVRGRILKDTKRF---------AVDMGADAENLIMHCNPRFEFSVDKNTIIFN 64

  Fly    66 SRINGAWGEEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRAL 130
            |:.||.||.|:.....|..     ...|..|::..  ||...:.:.......|..|.|:..|..|
 Frog    65 SKQNGVWGTEQKETAFPFQ-----AGSETMLIFEF--EDCITVLLPDGTEVPFTCRFPIDVINYL 122

  Fly   131 EI 132
            .:
 Frog   123 AL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 34/132 (26%)
GLECT 172..297 CDD:238025
lgals1.3NP_001135709.1 GLECT 13..135 CDD:214596 32/130 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.