DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5493 and cdo1

DIOPT Version :9

Sequence 1:NP_001246409.1 Gene:CG5493 / 37139 FlyBaseID:FBgn0034364 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_989132.1 Gene:cdo1 / 394737 XenbaseID:XB-GENE-998513 Length:201 Species:Xenopus tropicalis


Alignment Length:195 Identity:108/195 - (55%)
Similarity:140/195 - (71%) Gaps:15/195 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NSLSDLVAALHREFESNYVNIEMVNHLMLSYKSNPREWRKYAKFDRYTYTRNLVDAGNGKFNLLI 104
            |:|.:|:..||..|.|:.||||.|..::.||:||||||.|:||||:|.|||||||.|||||||:|
 Frog    10 NTLDELIQILHEIFASDKVNIEEVQAIVESYESNPREWMKFAKFDQYRYTRNLVDEGNGKFNLMI 74

  Fly   105 LCWGEGHGSSVHDHADSHCFMKMLKGDLREKRYEYPNRSARDNGRSHHPDGEIDSRELVEIGETP 169
            ||||||||||:||||:||||:|:|:|.|:|..||:|.:.:              :.|:|:..|..
 Frog    75 LCWGEGHGSSIHDHANSHCFLKILQGSLKETLYEWPKKKS--------------NTEMVKKAEGV 125

  Fly   170 IAVNDVAYINDNLGLHRVENPSHSDTSVSLHLYCPPFDTCSVFQDNLKKT-TAKVTFWSKYGVRT 233
            :.:|..|||||::||||||||||::.:||||||.|||:.|..|......| :.|:|||||||.||
 Frog   126 LKLNQCAYINDSIGLHRVENPSHTEPAVSLHLYSPPFNECHTFDQRTGHTNSVKMTFWSKYGDRT 190

  Fly   234  233
             Frog   191  190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5493NP_001246409.1 cupin_like 29..212 CDD:304367 96/171 (56%)
cdo1NP_989132.1 CDO_I 1..171 CDD:283616 97/174 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2729
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1365
Inparanoid 1 1.050 230 1.000 Inparanoid score I3367
OMA 1 1.010 - - QHG58293
OrthoDB 1 1.010 - - D1516232at2759
OrthoFinder 1 1.000 - - FOG0006302
OrthoInspector 1 1.000 - - oto102493
Panther 1 1.100 - - LDO PTHR12918
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4585
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.