DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5493 and CDO1

DIOPT Version :9

Sequence 1:NP_001246409.1 Gene:CG5493 / 37139 FlyBaseID:FBgn0034364 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001310494.1 Gene:CDO1 / 1036 HGNCID:1795 Length:219 Species:Homo sapiens


Alignment Length:213 Identity:102/213 - (47%)
Similarity:136/213 - (63%) Gaps:35/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SLSDLVAALHREFESNYVNIEMVNHLMLSYKSNPREWRKYAKFDRYT------------------ 87
            :|:||:..||:.|..:.||:|.|..:|.:|:|:|.||..|||||:|:                  
Human    11 TLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYSRGRGLQFVVGGGSGGGWL 75

  Fly    88 -YTRNLVDAGNGKFNLLILCWGEGHGSSVHDHADSHCFMKMLKGDLREKRYEYPNRSARDNGRSH 151
             |||||||.|||||||:|||||||||||:|||.:||||:|||:|:|:|..:.:|::.        
Human    76 WYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKK-------- 132

  Fly   152 HPDGEIDSRELVEIGETPIAVNDVAYINDNLGLHRVENPSHSDTSVSLHLYCPPFDTCSVF-QDN 215
                   |.|:|:..|..:..|..|||||::|||||||.||::.:||||||.||||||..| |..
Human   133 -------SNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRT 190

  Fly   216 LKKTTAKVTFWSKYGVRT 233
            ..|....:||.||:|:||
Human   191 GHKNKVTMTFHSKFGIRT 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5493NP_001246409.1 cupin_like 29..212 CDD:304367 92/189 (49%)
CDO1NP_001310494.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147738
Domainoid 1 1.000 202 1.000 Domainoid score I2997
eggNOG 1 0.900 - - E1_KOG4064
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1365
Inparanoid 1 1.050 214 1.000 Inparanoid score I3632
Isobase 1 0.950 - 0 Normalized mean entropy S2871
OMA 1 1.010 - - QHG58293
OrthoDB 1 1.010 - - D1516232at2759
OrthoFinder 1 1.000 - - FOG0006302
OrthoInspector 1 1.000 - - oto88617
orthoMCL 1 0.900 - - OOG6_103966
Panther 1 1.100 - - LDO PTHR12918
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2446
SonicParanoid 1 1.000 - - X4585
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.