DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5327 and CG5323

DIOPT Version :10

Sequence 1:NP_725807.1 Gene:CG5327 / 37138 FlyBaseID:FBgn0034363 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_611346.1 Gene:CG5323 / 37137 FlyBaseID:FBgn0034362 Length:146 Species:Drosophila melanogaster


Alignment Length:140 Identity:66/140 - (47%)
Similarity:106/140 - (75%) Gaps:0/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVEQQKKRLEGAISEMIEDMYRTHLRRMQSTMHRCAARCCDDDRGTLESVQNCIEKCAGPLMDAQ 65
            |::||::::|.|::|||:||.:||||:||:.||.|||:||.|...:::|||.|:::|:.|:..||
  Fly     1 MIQQQRQKIEAAVTEMIDDMDKTHLRKMQNEMHLCAAKCCQDGTSSVDSVQRCVDRCSAPMTRAQ 65

  Fly    66 DFLQHELGQFQNRLQNCVRDCNSDARSQMPSNPSDRDMSRSQHMFESCTNNCVDKYINLIPGLLK 130
            :::|||||:||.|||.||..||.|.:.:||.:|::..:::....||.|...||||::.||||::|
  Fly    66 NYVQHELGEFQGRLQRCVMQCNDDVKVKMPPSPNEDQIAKYTDQFERCAIQCVDKHVGLIPGMMK 130

  Fly   131 SIKQTLDRGP 140
            ::|..|.:||
  Fly   131 TMKAVLSKGP 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5327NP_725807.1 DUF842 5..130 CDD:461747 59/124 (48%)
CG5323NP_611346.1 DUF842 5..130 CDD:461747 59/124 (48%)

Return to query results.
Submit another query.