DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5323 and FAM136A

DIOPT Version :9

Sequence 1:NP_611346.1 Gene:CG5323 / 37137 FlyBaseID:FBgn0034362 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001316681.1 Gene:FAM136A / 84908 HGNCID:25911 Length:245 Species:Homo sapiens


Alignment Length:112 Identity:48/112 - (42%)
Similarity:65/112 - (58%) Gaps:4/112 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QNEMHLCAAKCCQDGTSSVDSVQRCVDRCSAPMTRAQNYVQHELGEFQGRLQRCVMQCNDDVKVK 93
            |..|..|:|.||:|..:|:..|.:|::||..|:.:||..|..||.:||.||.||.|.|||..|..
Human   136 QGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKDS 200

  Fly    94 MPPSPNEDQIAKYTDQFERCAIQCVDKHVGLIPGMMKTMK-AVLSKG 139
            :.....|.|:.:   |.:.|..:|||.|:.|||.|.|.|| |:||.|
Human   201 IDAGSKELQVKQ---QLDSCVTKCVDDHMHLIPTMTKKMKEALLSIG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5323NP_611346.1 DUF842 5..130 CDD:283469 41/100 (41%)
FAM136ANP_001316681.1 DUF842 132..234 CDD:310419 41/100 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142851
Domainoid 1 1.000 111 1.000 Domainoid score I6251
eggNOG 1 0.900 - - E1_KOG3377
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I4840
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58561
OrthoDB 1 1.010 - - D1456794at2759
OrthoFinder 1 1.000 - - FOG0003130
OrthoInspector 1 1.000 - - otm40518
orthoMCL 1 0.900 - - OOG6_104377
Panther 1 1.100 - - LDO PTHR21096
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2929
SonicParanoid 1 1.000 - - X2515
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.