DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5323 and AT1G05730

DIOPT Version :9

Sequence 1:NP_611346.1 Gene:CG5323 / 37137 FlyBaseID:FBgn0034362 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_172064.2 Gene:AT1G05730 / 837080 AraportID:AT1G05730 Length:149 Species:Arabidopsis thaliana


Alignment Length:138 Identity:33/138 - (23%)
Similarity:64/138 - (46%) Gaps:9/138 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IQQQRQKIEAAVTEMIDDMDKTHLR-KMQNEMHLCAAKCCQDGTSSVDSVQRCVDRCSAPMTRAQ 65
            |:::.:::.|.....:..: :.|:. .:|.....||.:|. |.....:.:..||:.||.|:..||
plant    16 IRRKLEEVNATAQSQLSPI-QDHINFTLQQAYFKCAYECF-DRNRKQEEIANCVEHCSVPVVNAQ 78

  Fly    66 NYVQHELGEFQGRLQRCVMQCNDDVK-VKMPPSPNEDQIAKYTDQFERCAIQCVDKHVGLIPGMM 129
            .:.:.|:.:||.|:.|.:|.|.|..: .|:  ..|....||   ..|.|....::..:..:|.::
plant    79 QHFEGEMSQFQERMNRSLMVCQDKFEAAKL--HKNRGDAAK---AMESCVNTSIEDSLDTLPHIV 138

  Fly   130 KTMKAVLS 137
            :.||...|
plant   139 QRMKTSFS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5323NP_611346.1 DUF842 5..130 CDD:283469 29/126 (23%)
AT1G05730NP_172064.2 DUF842 19..139 CDD:283469 29/126 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3658
eggNOG 1 0.900 - - E1_KOG3377
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I2496
OMA 1 1.010 - - QHG58561
OrthoDB 1 1.010 - - D1456794at2759
OrthoFinder 1 1.000 - - FOG0003130
OrthoInspector 1 1.000 - - otm3063
orthoMCL 1 0.900 - - OOG6_104377
Panther 1 1.100 - - O PTHR21096
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2515
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.