DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5323 and AT2G43720

DIOPT Version :9

Sequence 1:NP_611346.1 Gene:CG5323 / 37137 FlyBaseID:FBgn0034362 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_181900.1 Gene:AT2G43720 / 818974 AraportID:AT2G43720 Length:147 Species:Arabidopsis thaliana


Alignment Length:140 Identity:41/140 - (29%)
Similarity:67/140 - (47%) Gaps:14/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RQKIEAAVTEMIDDMDKTHLRKMQNEMHL--------CAAKCCQDGTSSVDSVQRCVDRCSAPMT 62
            |::|...|.| :....::.|..:|:.::.        ||.:|. |.|.:...:.||.:.||.|:|
plant    11 RERIRKKVNE-VSSASQSLLSPVQDHINFTLQKAYFKCAYECF-DRTRTHAEISRCAESCSVPIT 73

  Fly    63 RAQNYVQHELGEFQGRLQRCVMQCNDDVKVKMPPSPNEDQIAKYTDQFERCAIQCVDKHVGLIPG 127
            .||||..:|:..||.||.|.::.|.|..:|........:.:    :..|.|..|.||:.|..:|.
plant    74 NAQNYFDNEMSVFQERLNRSLVVCQDKFEVAKQQKTRSEAV----NDLEHCVNQTVDEAVKTLPN 134

  Fly   128 MMKTMKAVLS 137
            ::..||..||
plant   135 LVSRMKKALS 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5323NP_611346.1 DUF842 5..130 CDD:283469 37/131 (28%)
AT2G43720NP_181900.1 DUF842 17..137 CDD:399073 35/125 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3658
eggNOG 1 0.900 - - E1_KOG3377
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I2496
OMA 1 1.010 - - QHG58561
OrthoDB 1 1.010 - - D1456794at2759
OrthoFinder 1 1.000 - - FOG0003130
OrthoInspector 1 1.000 - - otm3063
orthoMCL 1 0.900 - - OOG6_104377
Panther 1 1.100 - - O PTHR21096
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2515
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.