DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5323 and AT2G31725

DIOPT Version :9

Sequence 1:NP_611346.1 Gene:CG5323 / 37137 FlyBaseID:FBgn0034362 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_565729.1 Gene:AT2G31725 / 817729 AraportID:AT2G31725 Length:149 Species:Arabidopsis thaliana


Alignment Length:145 Identity:36/145 - (24%)
Similarity:70/145 - (48%) Gaps:22/145 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QQQRQKIE----AAVTEMIDDMDKTHLR-KMQNEMHLCAAKCCQDGTSSVDSVQRCVDRCSAPMT 62
            ::.|:|:|    ||.|::....|  |:. .:|.....||.:|. |.....:.:..||:.||.|:.
plant    14 ERLRRKLEEVNVAAQTQLSPIQD--HINFTLQQAYFKCAYECF-DRRRKQEEISNCVEHCSVPVV 75

  Fly    63 RAQNYVQHELGEFQGRLQRCVMQCNDDVKVK-----MPPSPNEDQIAKYTDQFERCAIQCVDKHV 122
            ::|.|.::|:.:||.||.|.::.|.|..:..     .|.:.||         .|.|..:.:::::
plant    76 KSQQYFENEMAQFQERLNRSLVVCQDKFEASKLQKIRPEAVNE---------MESCVHKSIEENL 131

  Fly   123 GLIPGMMKTMKAVLS 137
            ..:|.:::.||...:
plant   132 NTLPHIVQRMKTAFN 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5323NP_611346.1 DUF842 5..130 CDD:283469 34/134 (25%)
AT2G31725NP_565729.1 DUF842 19..139 CDD:399073 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3658
eggNOG 1 0.900 - - E1_KOG3377
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I2496
OMA 1 1.010 - - QHG58561
OrthoDB 1 1.010 - - D1456794at2759
OrthoFinder 1 1.000 - - FOG0003130
OrthoInspector 1 1.000 - - otm3063
orthoMCL 1 0.900 - - OOG6_104377
Panther 1 1.100 - - LDO PTHR21096
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2515
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.