DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5323 and Fam136a

DIOPT Version :9

Sequence 1:NP_611346.1 Gene:CG5323 / 37137 FlyBaseID:FBgn0034362 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_079867.1 Gene:Fam136a / 66488 MGIID:1913738 Length:138 Species:Mus musculus


Alignment Length:137 Identity:56/137 - (40%)
Similarity:81/137 - (59%) Gaps:3/137 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIQQQRQKIEAAVTEMIDDMDKTHLRKMQNEMHLCAAKCCQDGTSSVDSVQRCVDRCSAPMTRAQ 65
            |.:.|:.:::.||..|:..:::.::||||..|..|:|.||:|..:|:..|.:|::||.||:.:||
Mouse     1 MAEVQQLRVQEAVDAMVKSVERENIRKMQGLMFRCSANCCEDTQASMQQVHQCIERCHAPLAQAQ 65

  Fly    66 NYVQHELGEFQGRLQRCVMQCNDDVKVKMPPSPNEDQIAKYTDQFERCAIQCVDKHVGLIPGMMK 130
            ..|..||..||.||.||.|.|||..|..|.....|.|:.:   |.:.|..:|||.|:.|||.|.|
Mouse    66 ALVTSELERFQDRLARCTMHCNDKAKDSMDAGTKELQVKR---QLDSCVTKCVDDHMHLIPTMTK 127

  Fly   131 TMKAVLS 137
            .||..||
Mouse   128 KMKESLS 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5323NP_611346.1 DUF842 5..130 CDD:283469 50/124 (40%)
Fam136aNP_079867.1 DUF842 5..127 CDD:283469 50/124 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832975
Domainoid 1 1.000 113 1.000 Domainoid score I6114
eggNOG 1 0.900 - - E1_KOG3377
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4805
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58561
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003130
OrthoInspector 1 1.000 - - otm42591
orthoMCL 1 0.900 - - OOG6_104377
Panther 1 1.100 - - LDO PTHR21096
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2929
SonicParanoid 1 1.000 - - X2515
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.