DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5323 and fam136a

DIOPT Version :9

Sequence 1:NP_611346.1 Gene:CG5323 / 37137 FlyBaseID:FBgn0034362 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_998565.1 Gene:fam136a / 406709 ZFINID:ZDB-GENE-040426-2729 Length:138 Species:Danio rerio


Alignment Length:145 Identity:54/145 - (37%)
Similarity:84/145 - (57%) Gaps:7/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIQQQRQKIEAAVTEMIDDMDKTHLRKMQNEMHLCAAKCCQDGTSSVDSVQRCVDRCSAPMTRAQ 65
            |.:.|:.:::.||.||:.:::|.|:||||..|..|:|:||:...:|::.|.:|::||..|:.:||
Zfish     1 MAEAQQARVQNAVEEMVQNLEKEHIRKMQGRMFRCSAECCEHPGNSMNQVHQCIERCHTPLAKAQ 65

  Fly    66 NYVQHELGEFQGRLQRCVMQCNDDVKVKMPPSPNEDQIAKYTDQFERCAIQCVDKHVGLIPGMMK 130
            ..|..||.:||.||.||.|.|:|..|........|..:....|   .|...|||:|:.|:|.|.:
Zfish    66 GLVTSELEQFQDRLSRCTMHCSDKAKDLFDSGAKEPAVRALMD---GCVGSCVDEHLNLLPSMTR 127

  Fly   131 TMKAVLSKGPESIPQ 145
            .:|..|:    ||||
Zfish   128 RLKDSLN----SIPQ 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5323NP_611346.1 DUF842 5..130 CDD:283469 47/124 (38%)
fam136aNP_998565.1 DUF842 5..127 CDD:283469 47/124 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575686
Domainoid 1 1.000 109 1.000 Domainoid score I6301
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134211
Inparanoid 1 1.050 113 1.000 Inparanoid score I4830
OMA 1 1.010 - - QHG58561
OrthoDB 1 1.010 - - D1456794at2759
OrthoFinder 1 1.000 - - FOG0003130
OrthoInspector 1 1.000 - - otm26626
orthoMCL 1 0.900 - - OOG6_104377
Panther 1 1.100 - - LDO PTHR21096
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2515
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.