DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5323 and CG5327

DIOPT Version :9

Sequence 1:NP_611346.1 Gene:CG5323 / 37137 FlyBaseID:FBgn0034362 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_725807.1 Gene:CG5327 / 37138 FlyBaseID:FBgn0034363 Length:149 Species:Drosophila melanogaster


Alignment Length:140 Identity:66/140 - (47%)
Similarity:106/140 - (75%) Gaps:0/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIQQQRQKIEAAVTEMIDDMDKTHLRKMQNEMHLCAAKCCQDGTSSVDSVQRCVDRCSAPMTRAQ 65
            |::||::::|.|::|||:||.:||||:||:.||.|||:||.|...:::|||.|:::|:.|:..||
  Fly     1 MVEQQKKRLEGAISEMIEDMYRTHLRRMQSTMHRCAARCCDDDRGTLESVQNCIEKCAGPLMDAQ 65

  Fly    66 NYVQHELGEFQGRLQRCVMQCNDDVKVKMPPSPNEDQIAKYTDQFERCAIQCVDKHVGLIPGMMK 130
            :::|||||:||.|||.||..||.|.:.:||.:|::..:::....||.|...||||::.||||::|
  Fly    66 DFLQHELGQFQNRLQNCVRDCNSDARSQMPSNPSDRDMSRSQHMFESCTNNCVDKYINLIPGLLK 130

  Fly   131 TMKAVLSKGP 140
            ::|..|.:||
  Fly   131 SIKQTLDRGP 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5323NP_611346.1 DUF842 5..130 CDD:283469 59/124 (48%)
CG5327NP_725807.1 DUF842 5..130 CDD:283469 59/124 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440462
Domainoid 1 1.000 64 1.000 Domainoid score I3658
eggNOG 1 0.900 - - E1_KOG3377
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I2496
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456794at2759
OrthoFinder 1 1.000 - - FOG0003130
OrthoInspector 1 1.000 - - otm26626
orthoMCL 1 0.900 - - OOG6_104377
Panther 1 1.100 - - P PTHR21096
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2515
1110.800

Return to query results.
Submit another query.