DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5323 and ZK637.2

DIOPT Version :9

Sequence 1:NP_611346.1 Gene:CG5323 / 37137 FlyBaseID:FBgn0034362 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001379046.1 Gene:ZK637.2 / 176252 WormBaseID:WBGene00014022 Length:143 Species:Caenorhabditis elegans


Alignment Length:132 Identity:51/132 - (38%)
Similarity:79/132 - (59%) Gaps:3/132 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IQQQRQKIEAAVTEMIDDMDKTHLRKMQNEMHLCAAKCCQDGTSSVDSVQRCVDRCSAPMTRAQN 66
            ::..:.|::.||.|||||:|||:||.||..|..|:|:||.:..::.|:|:.||:.|:..|.:||.
 Worm     6 MEATQMKVKLAVDEMIDDLDKTYLRDMQKSMFQCSARCCDNKKTTRDAVENCVESCNDGMKKAQG 70

  Fly    67 YVQHELGEFQGRLQRCVMQCNDDVKVKMPPSPN---EDQIAKYTDQFERCAIQCVDKHVGLIPGM 128
            |::.|||..|.:|.||.|.|.|.:..:..|..|   |.|...:.::.:.|...|.|.|:.|||.:
 Worm    71 YLEKELGGLQDQLSRCAMTCYDKLVQQFGPDVNKYSESQKLSFNEKLDSCVSVCADDHIKLIPAI 135

  Fly   129 MK 130
            .|
 Worm   136 KK 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5323NP_611346.1 DUF842 5..130 CDD:283469 50/127 (39%)
ZK637.2NP_001379046.1 DUF842 10..137 CDD:399073 50/126 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157334
Domainoid 1 1.000 111 1.000 Domainoid score I3910
eggNOG 1 0.900 - - E1_KOG3377
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134211
Inparanoid 1 1.050 111 1.000 Inparanoid score I3442
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58561
OrthoDB 1 1.010 - - D1456794at2759
OrthoFinder 1 1.000 - - FOG0003130
OrthoInspector 1 1.000 - - otm14596
orthoMCL 1 0.900 - - OOG6_104377
Panther 1 1.100 - - LDO PTHR21096
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2929
SonicParanoid 1 1.000 - - X2515
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.