DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS28 and Mrps28

DIOPT Version :9

Sequence 1:NP_523785.2 Gene:mRpS28 / 37136 FlyBaseID:FBgn0034361 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001041374.1 Gene:Mrps28 / 689025 RGDID:1597461 Length:235 Species:Rattus norvegicus


Alignment Length:121 Identity:44/121 - (36%)
Similarity:62/121 - (51%) Gaps:31/121 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PEDNQTFASLLRNSKLIDLDNAEGKVVSGKIFHVVGDDLYIDFGWKFHCVCSRP----------- 129
            |:..::|||:||:|.|..:..|:.|:|.|:|||:|.||||||||.||||||.||           
  Rat    72 PKPVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVEDDLYIDFGGKFHCVCKRPDVDGELTCCGK 136

  Fly   130 -TRNASDYVRGARVRLRIKDLELSTKFLGSSKDITILEADCHLLGLLSTPTRQSTA 184
             ..||.:.|....|.:..:.|::|..          |::.||.         :|||
  Rat   137 VNMNAIEIVLLRIVWVLPESLQISNG----------LQSVCHF---------ESTA 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS28NP_523785.2 MRP-S35 76..180 CDD:287248 41/115 (36%)
Mrps28NP_001041374.1 MRP-S35 72..>130 CDD:287248 32/57 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354465
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566742at2759
OrthoFinder 1 1.000 - - FOG0007349
OrthoInspector 1 1.000 - - oto96333
orthoMCL 1 0.900 - - OOG6_108933
Panther 1 1.100 - - LDO PTHR13447
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5469
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.