DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS28 and mrps-28

DIOPT Version :9

Sequence 1:NP_523785.2 Gene:mRpS28 / 37136 FlyBaseID:FBgn0034361 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_507808.1 Gene:mrps-28 / 180287 WormBaseID:WBGene00012830 Length:172 Species:Caenorhabditis elegans


Alignment Length:111 Identity:57/111 - (51%)
Similarity:74/111 - (66%) Gaps:0/111 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 NQTFASLLRNSKLIDLDNAEGKVVSGKIFHVVGDDLYIDFGWKFHCVCSRPTRNASDYVRGARVR 143
            ||:|||||||||.:.|.:..|::|.|||...|.:|:|||||.||:.||..|..|:..|..||||.
 Worm    45 NQSFASLLRNSKFMQLGDFNGRLVVGKIAQRVQEDVYIDFGLKFNAVCKVPALNSEAYRSGARVL 109

  Fly   144 LRIKDLELSTKFLGSSKDITILEADCHLLGLLSTPTRQSTAKTTPK 189
            :|:.|.|||.:||||..|:|:||||..|:.|||...||...:..|:
 Worm   110 IRLIDPELSERFLGSKHDLTLLEADAVLVRLLSNVPRQQQQRQKPR 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS28NP_523785.2 MRP-S35 76..180 CDD:287248 54/100 (54%)
mrps-28NP_507808.1 MRP-S35 42..145 CDD:287248 54/99 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167846
Domainoid 1 1.000 103 1.000 Domainoid score I4277
eggNOG 1 0.900 - - E1_KOG4078
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I3478
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566742at2759
OrthoFinder 1 1.000 - - FOG0007349
OrthoInspector 1 1.000 - - oto17869
orthoMCL 1 0.900 - - OOG6_108933
Panther 1 1.100 - - LDO PTHR13447
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4443
SonicParanoid 1 1.000 - - X5469
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.