DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS28 and mrps28

DIOPT Version :9

Sequence 1:NP_523785.2 Gene:mRpS28 / 37136 FlyBaseID:FBgn0034361 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001096286.1 Gene:mrps28 / 100124857 XenbaseID:XB-GENE-6457765 Length:169 Species:Xenopus tropicalis


Alignment Length:138 Identity:65/138 - (47%)
Similarity:88/138 - (63%) Gaps:19/138 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ESTPAVNTETAEIGSSKGGFARAFDKYTAPATPPQLPEDNQTFASLLRNSKLIDLDNAEGKVVSG 104
            |..|| |.:|||.|..                  :|.:..::||||||.|.|:.:..::.|:..|
 Frog    47 EGKPA-NVQTAETGGK------------------ELFKGTESFASLLRRSPLVQMGPSKDKIAIG 92

  Fly   105 KIFHVVGDDLYIDFGWKFHCVCSRPTRNASDYVRGARVRLRIKDLELSTKFLGSSKDITILEADC 169
            ||||:||||||:|||.||||||.||.::...|.:|.|||||:.||||:::|||::.|.|:||||.
 Frog    93 KIFHIVGDDLYVDFGGKFHCVCKRPEQDGEKYQKGMRVRLRLVDLELTSRFLGATTDTTLLEADA 157

  Fly   170 HLLGLLST 177
            .|||||.:
 Frog   158 VLLGLLES 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS28NP_523785.2 MRP-S35 76..180 CDD:287248 56/102 (55%)
mrps28NP_001096286.1 MRP-S35 68..168 CDD:313472 56/98 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I5467
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8519
Inparanoid 1 1.050 126 1.000 Inparanoid score I4550
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566742at2759
OrthoFinder 1 1.000 - - FOG0007349
OrthoInspector 1 1.000 - - oto103051
Panther 1 1.100 - - LDO PTHR13447
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4443
SonicParanoid 1 1.000 - - X5469
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.