DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10927 and tadA

DIOPT Version :10

Sequence 1:NP_611345.1 Gene:CG10927 / 37135 FlyBaseID:FBgn0034360 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_417054.2 Gene:tadA / 947027 ECOCYCID:EG11372 Length:167 Species:Escherichia coli


Alignment Length:53 Identity:18/53 - (33%)
Similarity:32/53 - (60%) Gaps:1/53 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 IYLLQEPCLMCSMALVHSRAKRVFF-VKNSENGALATRFQLHSVRELNHHYEV 348
            :|:..|||:||:.|::|||..||.| .::::.||..:...:.....:||..|:
E. coli    80 LYVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDVLHHPGMNHRVEI 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10927NP_611345.1 cytidine_deaminase-like <274..329 CDD:444801 13/32 (41%)
tadANP_417054.2 PRK10860 1..167 CDD:182786 18/53 (34%)

Return to query results.
Submit another query.