DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10927 and PHS1

DIOPT Version :10

Sequence 1:NP_611345.1 Gene:CG10927 / 37135 FlyBaseID:FBgn0034360 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_190323.1 Gene:PHS1 / 823893 AraportID:AT3G47390 Length:599 Species:Arabidopsis thaliana


Alignment Length:195 Identity:37/195 - (18%)
Similarity:60/195 - (30%) Gaps:79/195 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VIQELSQKLPHFQHLKRVQDRSVLICPSSEIGVSQSLEQHLEQFAFSEHVLRALCQGVRVVEVPE 119
            ::...|..||...:|..|.:.|.::.  ::.|..:|.::.|..            :||.|||...
plant   256 IVMTQSLDLPEKANLWDVSEVSTIVV--TQRGARKSFQKLLAS------------KGVEVVEFDM 306

  Fly   120 RMPRLRVQYEKTLKHWPCKFHPNHYSESL--RNGSNFSSA--QRTFHKRIGQLLVRLSRDVNANR 180
            ..||..::|          ||...|...|  ..|:..:||  ....||.:..:..::.....|..
plant   307 LNPREVMEY----------FHLRGYLSILWECGGTLAASAISSSVIHKVVAFVAPKIIGGSKAPS 361

  Fly   181 PVG---------------IC------------------------------------VDPRQPSIV 194
            |||               :|                                    |||.:|||:
plant   362 PVGDLGMVEMTQALNLIDVCYEQVGPDMLVSGFLQPIPDLLPVIPSEDATVEIDPSVDPFEPSII 426

  Fly   195  194
            plant   427  426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10927NP_611345.1 cytidine_deaminase-like <274..329 CDD:444801
PHS1NP_190323.1 DHFR 36..390 CDD:473077 31/157 (20%)
NADAR 424..583 CDD:271319 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.