DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10927 and Adat2

DIOPT Version :10

Sequence 1:NP_611345.1 Gene:CG10927 / 37135 FlyBaseID:FBgn0034360 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_080024.3 Gene:Adat2 / 66757 MGIID:1914007 Length:191 Species:Mus musculus


Alignment Length:66 Identity:19/66 - (28%)
Similarity:30/66 - (45%) Gaps:11/66 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 NNE------DYKDLTFGAEKSRECKEVDAVQGADNLAKFGPYLCTGYD---IYLLQEPCLMCSMA 310
            |||      :..:.|..|.:..|...:|.|  .|...:.|....|.::   :|:..|||:||:.|
Mouse    51 NNEVVGKGRNEVNQTKNATRHAEMVAIDQV--LDWCHQHGQSPSTVFEHTVLYVTVEPCIMCAAA 113

  Fly   311 L 311
            |
Mouse   114 L 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10927NP_611345.1 cytidine_deaminase-like <274..329 CDD:444801 13/41 (32%)
Adat2NP_080024.3 TadA 23..173 CDD:440355 19/66 (29%)

Return to query results.
Submit another query.