DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GEFmeso and Arhgef6

DIOPT Version :10

Sequence 1:NP_788403.2 Gene:GEFmeso / 37134 FlyBaseID:FBgn0050115 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_690014.3 Gene:Arhgef6 / 73341 MGIID:1920591 Length:771 Species:Mus musculus


Alignment Length:134 Identity:34/134 - (25%)
Similarity:55/134 - (41%) Gaps:38/134 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PSD---SLEDDLEEVYRTCNTQSAVEWINDDDELERLDLPLESLD---PTGGGTVFNRVDSSDII 125
            |:|   |.:.||.:..||| |...|.:.|.:...|::...||.:|   ...||:.:     :...
Mouse   167 PNDVIASSDKDLRDFIRTC-TGGFVFFNNKNTGFEQVSKLLEKIDTLVAVNGGSCY-----TTSF 225

  Fly   126 YQEKKKKCKLVGKYVMGDVLGEGSYGKVKEVLDSETLNRRAVKILTKRKLRRIPNGEQNVRSEIK 190
            |...:||.:                .|.:::|:     .|..:|  .||||.:   |:|...|.:
Mouse   226 YPASEKKIR----------------EKQEKILE-----ERHEEI--ARKLREL---EENCEGEGE 264

  Fly   191 LLRK 194
            |.||
Mouse   265 LERK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GEFmesoNP_788403.2 RhoGEF 548..712 CDD:459876
PH_PLEKHG1_G2_G3 694..839 CDD:270063
Arhgef6NP_690014.3 CH_alphaPIX 1..117 CDD:409114
RhoGEF67_u1 115..159 CDD:465201
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..157
SH3_alphaPIX 161..217 CDD:212993 15/50 (30%)
RhoGEF 241..418 CDD:238091 13/38 (34%)
PH_Cool_Pix 449..547 CDD:269932
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..580
RhoGEF67_u2 575..673 CDD:465200
betaPIX_CC 680..764 CDD:465158
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.