DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GEFmeso and pex13

DIOPT Version :9

Sequence 1:NP_788403.2 Gene:GEFmeso / 37134 FlyBaseID:FBgn0050115 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_593611.1 Gene:pex13 / 2543046 PomBaseID:SPAC3C7.10 Length:288 Species:Schizosaccharomyces pombe


Alignment Length:177 Identity:34/177 - (19%)
Similarity:59/177 - (33%) Gaps:65/177 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 NRPLSSSSICSTSSSSSSGSDQLLNGKLMA-----TSYLASVESLAESENELG------------ 531
            |.|:||..:..:...:.....|:|...|||     .::::..|:|.:.::.:|            
pombe    79 NGPISSLQVIESIVGAVGSIAQVLESTLMAAHMSYNTFVSVSENLNKLKSSIGAIFGIVSLLSRL 143

  Fly   532 -------------DQHHPPAMSVLEKTCLEIVDSERSFVEDLGQVI------------------- 564
                         |:.:.....|.||......:|..|.|..|..::                   
pombe   144 KRLVLKFFKHSKIDEMNSQEYDVFEKEEGNHKNSIYSIVSSLAIILGLVGLPYAIIRLFKNIYEK 208

  Fly   565 KGYLQDWKERACLRVDELQILFANIEEIYEFNSMLLQRLINTGRDPG 611
            :..:|..|.|.  ::|.|:...|:    |||.|          ||||
pombe   209 EKQIQQAKIRK--KIDSLEFCKAD----YEFMS----------RDPG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GEFmesoNP_788403.2 RhoGEF 548..713 CDD:279015 18/83 (22%)
PH_PLEKHG1_G2_G3 694..839 CDD:270063
pex13NP_593611.1 Peroxin-13_N 86..202 CDD:282008 16/115 (14%)
SH3_Pex13p_fungal 226..285 CDD:212705 9/28 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.