DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GEFmeso and ARHGEF9

DIOPT Version :9

Sequence 1:NP_788403.2 Gene:GEFmeso / 37134 FlyBaseID:FBgn0050115 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_001340852.1 Gene:ARHGEF9 / 23229 HGNCID:14561 Length:529 Species:Homo sapiens


Alignment Length:417 Identity:102/417 - (24%)
Similarity:181/417 - (43%) Gaps:75/417 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 ESLAESENELGDQHHPPAMSVLEKTCL----------------EIVDSERSFVEDLGQVIKGYLQ 569
            :.:.|..:::.:.|..|....|   ||                ||:.:||.:::.|..:.:|||:
Human    83 DEVEEGPSDVQNGHLDPNSDCL---CLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICEGYLK 144

  Fly   570 DWKERACLRVDE-LQILFANIEEIYEFNSML---LQRLINTGRDP--GRIARCFIDLRDGFDVYT 628
            ..::|..:..|| |:::|.|||:||.|....   |::..|.. ||  ..|..||::.:|||.:|:
Human   145 QCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNND-DPHLSEIGPCFLEHQDGFWIYS 208

  Fly   629 TYCTSYPEAISLLTKLLQATHTYSLLASTQKLLQHRLPLG--SYLLKPVQRILKYHLLLDSLRK- 690
            .||.::.:|...|:||::.:. |.......:|||..:.:.  .:||.|||:|.||.|.|..|.| 
Human   209 EYCNNHLDACMELSKLMKDSR-YQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKY 272

  Fly   691 ----HCDVKEVVEAHVIMRQVAHNIDQVKRKQEQQSRVKELSGILDGWLG-------PELTVLGE 744
                |.|.:.|..|..:||.|...|::.||:.|...::.:....:..|.|       .||...||
Human   273 TAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQASVLDWEGEDILDRSSELIYTGE 337

  Fly   745 L----RQEGLLMEQHNKQRLVLLFATMLIITKQKEDGR--LQFKTYISQNNLMLSEHLPGEPTSF 803
            :    :..|     .|:||:..||...:::.|:....|  |.:|..|..:...:.:...|....|
Human   338 MAWIYQPYG-----RNQQRVFFLFDHQMVLCKKDLIRRDILYYKGRIDMDKYEVVDIEDGRDDDF 397

  Fly   804 YVIPFDEPRHQIKL-----------TARNRDQKRIWTQHIKGVMLEKLDIPMRAKELVYQLGNEE 857
            .|    ..::..||           .|:..::|..|.:..:    |:..:....:::.:::...:
Human   398 NV----SMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAFR----EERKMVQEDEKIGFEISENQ 454

  Fly   858 DRTPDRSTWKWSLHSGSNST----PTY 880
            .|....:..|.....|.||.    |:|
Human   455 KRQAAMTVRKVPKQKGVNSARSVPPSY 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GEFmesoNP_788403.2 RhoGEF 548..713 CDD:279015 60/177 (34%)
PH_PLEKHG1_G2_G3 694..839 CDD:270063 34/168 (20%)
ARHGEF9NP_001340852.1 SH3_ARHGEF9 20..81 CDD:212908
RhoGEF 120..299 CDD:214619 60/180 (33%)
PH_Collybistin_ASEF 304..443 CDD:269931 27/151 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.