DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GEFmeso and prx-13

DIOPT Version :9

Sequence 1:NP_788403.2 Gene:GEFmeso / 37134 FlyBaseID:FBgn0050115 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_495513.1 Gene:prx-13 / 174192 WormBaseID:WBGene00004198 Length:330 Species:Caenorhabditis elegans


Alignment Length:33 Identity:10/33 - (30%)
Similarity:13/33 - (39%) Gaps:8/33 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1206 PPSRSPPPLELEEQEKKPVEEVDSVSEEPIYET 1238
            ||:..||||        |....|:....|:..|
 Worm     4 PPTNQPPPL--------PPRSFDNQMSNPMINT 28

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GEFmesoNP_788403.2 RhoGEF 548..713 CDD:279015
PH_PLEKHG1_G2_G3 694..839 CDD:270063
prx-13NP_495513.1 Peroxin-13_N 70..217 CDD:282008
SH3_PEX13_eumet 239..297 CDD:212798
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.