powered by:
Protein Alignment GEFmeso and prx-13
DIOPT Version :9
Sequence 1: | NP_788403.2 |
Gene: | GEFmeso / 37134 |
FlyBaseID: | FBgn0050115 |
Length: | 1549 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495513.1 |
Gene: | prx-13 / 174192 |
WormBaseID: | WBGene00004198 |
Length: | 330 |
Species: | Caenorhabditis elegans |
Alignment Length: | 33 |
Identity: | 10/33 - (30%) |
Similarity: | 13/33 - (39%) |
Gaps: | 8/33 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 1206 PPSRSPPPLELEEQEKKPVEEVDSVSEEPIYET 1238
||:..|||| |....|:....|:..|
Worm 4 PPTNQPPPL--------PPRSFDNQMSNPMINT 28
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1291 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.