DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk2 and rem2

DIOPT Version :9

Sequence 1:NP_001286577.1 Gene:Rgk2 / 37132 FlyBaseID:FBgn0085419 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001116518.1 Gene:rem2 / 798285 ZFINID:ZDB-GENE-081110-1 Length:306 Species:Danio rerio


Alignment Length:280 Identity:80/280 - (28%)
Similarity:126/280 - (45%) Gaps:71/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   511 ATP-------DDSENLDPPPPARY---RVVMLGDAGVGKTALVNQFMTSEYMHTYDASLVLD--- 562
            |||       .||.:|.||....:   |:|:||..||||::|........     |.||.:|   
Zfish    49 ATPQISVTNIQDSPSLKPPQQKYHGPLRIVLLGQNGVGKSSLALCLAGLS-----DRSLSIDSET 108

  Fly   563 ---DEFGEKTVSVLLDDEESDMVFIDHPSVEMSVENSLSTYEPHGCVVVFSVVDRSSF-RVAEEI 623
               ||...:.|:|  |||:|.::..|:...|      |||.:...|::|||:.||.|| |:|:  
Zfish   109 QAADEGYPRRVTV--DDEDSSILVYDNWKQE------LSTLQCEVCILVFSLTDRRSFHRIAQ-- 163

  Fly   624 INYLWQENYTKDKAVILVGNKADLARARLITSQEGKALAASRDAKFIETSSGIQHNVDELLVGIL 688
            :..|.:|: .....:||||||:||.|:|.|:::|..:.|......::|.|..:.|..::||...:
Zfish   164 LRLLLRES-LPHTPIILVGNKSDLVRSREISTEEAHSSAMMFGCLYLELSVSLDHRTNDLLEAAV 227

  Fly   689 KQMR-------------LKEKREKKATASKMKTS----RTH--------------ISLHLAKELL 722
            :..|             ...:||...:.:|...|    |:|              :|.|....:|
Zfish   228 RAARGHSLGPGWTEGSPSAARRESLTSRAKRFLSGLVPRSHLGRERDREPGRDRDLSRHRGSRML 292

  Fly   723 QKICLSDISKSKSCENLHVL 742
            ::       ||:||.:|..|
Zfish   293 RQ-------KSRSCHDLSAL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk2NP_001286577.1 RGK 527..742 CDD:206715 71/255 (28%)
small_GTPase 527..694 CDD:197466 57/189 (30%)
rem2NP_001116518.1 P-loop_NTPase 75..305 CDD:304359 71/252 (28%)
Ras 76..231 CDD:278499 56/170 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.