DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk2 and RRAD

DIOPT Version :9

Sequence 1:NP_001286577.1 Gene:Rgk2 / 37132 FlyBaseID:FBgn0085419 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001122322.1 Gene:RRAD / 6236 HGNCID:10446 Length:308 Species:Homo sapiens


Alignment Length:257 Identity:90/257 - (35%)
Similarity:130/257 - (50%) Gaps:47/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 DSLPATPDDSENLDPPPPARYRVVMLGDAGVGKTALVNQFMTSE-------YMHTYDASLVLDDE 564
            |||.:...||:.      :.|:|::||..||||:||...|...|       ..||||.|:|:|  
Human    78 DSLSSGGSDSDE------SVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVD-- 134

  Fly   565 FGEKTVSVLLDDEESDMVFIDHPSVEMSVENSLSTYEPHGC-------VVVFSVVDRSSFRVAEE 622
             ||:...::.|..|.|.                ..:.|..|       |:|:||.|:.||..|.|
Human   135 -GEEASLMVYDIWEQDG----------------GRWLPGHCMAMGDAYVIVYSVTDKGSFEKASE 182

  Fly   623 IINYLWQENYTKDKAVILVGNKADLARARLITSQEGKALAASRDAKFIETSSGIQHNVDELLVGI 687
            :...|.:...|.|..:||||||:||.|:|.::..||:|.|...|.||||||:.:.|||..|..|:
Human   183 LRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGV 247

  Fly   688 LKQMRLKEKREKKATASKMKTSRTHISL-HLAKELLQKIC------LSDISKSKSCENLHVL 742
            ::|:||: :..|:|.|.:...:|...|| ..||..|.:|.      ::..:|||||.:|.||
Human   248 VRQIRLR-RDSKEANARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSKSCHDLSVL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk2NP_001286577.1 RGK 527..742 CDD:206715 83/235 (35%)
small_GTPase 527..694 CDD:197466 66/180 (37%)
RRADNP_001122322.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88 4/9 (44%)
RGK 92..308 CDD:206715 83/235 (35%)
RAS 92..252 CDD:214541 65/178 (37%)
Calmodulin-binding 278..297 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5084
SonicParanoid 1 1.000 - - X743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.