DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk2 and gem

DIOPT Version :9

Sequence 1:NP_001286577.1 Gene:Rgk2 / 37132 FlyBaseID:FBgn0085419 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001039314.1 Gene:gem / 560566 ZFINID:ZDB-GENE-060825-251 Length:291 Species:Danio rerio


Alignment Length:324 Identity:99/324 - (30%)
Similarity:152/324 - (46%) Gaps:67/324 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 RPYNPRASDDLYRLRHFSISKGNVVNCGDSIISRRSRSNTSVNSTNSRASERSPFEGSCCGAGYA 504
            |.::.|....|:|........|.::|  |:.    .||:.|::.::|.:|              |
Zfish     8 RRHSIRVQHHLHRWSICGTDGGQLLN--DAF----PRSDISMSRSSSCSS--------------A 52

  Fly   505 NVDSLPATPDDSENLDPPPPARYRVVMLGDAGVGKTALVNQF------MTSEYM----HTYDASL 559
            :.||..:|    |:..|.....:.||:|||.||||:||.:.|      |.||..    ..::.::
Zfish    53 SSDSALST----ESATPASVGPFTVVLLGDNGVGKSALASIFAGASDSMGSECELYGGEIFEQTI 113

  Fly   560 VLDDEFGEKTVSVLLDDEESDMVFIDHPSVEMSVENSLSTYEPHGCVVVFSVVDRSSFRVAEEII 624
            .:|   ||:....|||..:|.    |..|  .:.:..|.|.:  ..::|:::.|||||..|.::.
Zfish   114 TVD---GERASVTLLDTWDSQ----DEGS--WTQQRCLQTGD--AFIIVYAITDRSSFLRASDLR 167

  Fly   625 NYLWQENYTKDKAVILVGNKADLARARLITSQEGKALAASRDAKFIETSSGIQHNVDELLVGILK 689
            ..|.:|.......:||||||.||.|.|.::..||::.||..|.||||||:.:||||..|..||::
Zfish   168 VQLRREREVDRTPIILVGNKCDLVRCREVSISEGRSSAAVFDCKFIETSAAMQHNVWPLFEGIIR 232

  Fly   690 QMRLKEKREKKATASKMKTSRTHISLHLAKELLQKICLSDIS--------------KSKSCENL 739
            |:||:.        ..|:|..:|.||...:|.|.|.....|:              |||||.:|
Zfish   233 QLRLRR--------DSMETLSSHSSLQKRRESLPKKAKRFINRMVAKKNKQAAFKLKSKSCHDL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk2NP_001286577.1 RGK 527..742 CDD:206715 81/237 (34%)
small_GTPase 527..694 CDD:197466 65/176 (37%)
gemNP_001039314.1 RGK 71..291 CDD:206715 81/237 (34%)
small_GTPase 73..237 CDD:197466 65/174 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.