DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk2 and rrad

DIOPT Version :9

Sequence 1:NP_001286577.1 Gene:Rgk2 / 37132 FlyBaseID:FBgn0085419 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001016726.1 Gene:rrad / 549480 XenbaseID:XB-GENE-491671 Length:303 Species:Xenopus tropicalis


Alignment Length:280 Identity:96/280 - (34%)
Similarity:149/280 - (53%) Gaps:49/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 NTSVNSTNSRASERSPFEGSCCGAGYANVDSLPATPDDSENLDPPPPARYRVVMLGDAGVGKTAL 542
            |.|.....|.||:.|              ||:.::..|||:      ..|:|::||:.||||::|
 Frog    58 NPSDEHRESWASDSS--------------DSVISSGSDSED------HVYKVILLGEHGVGKSSL 102

  Fly   543 VNQFMTSEYMH-------TYDASLVLDDEFGEKTVSVLLDD-EESDMVFIDHPSVEMSVENSLST 599
            ...|...|.:|       |||.|:|:|   ||:...::.|. |:.|..::.:..::|.     ..
 Frog   103 ARIFGGVEDLHDVEEAGNTYDRSIVVD---GEEACLLVFDIWEQDDNHWLHNQCMKMG-----DA 159

  Fly   600 YEPHGCVVVFSVVDRSSFRVAEEIINYLWQENYTKDKAVILVGNKADLARARLITSQEGKALAAS 664
            |     |:|:||.|::||..|.|:...|.:...::|..:||||||:||.|:|.::.:||:|.|..
 Frog   160 Y-----VIVYSVTDKASFEKASELRIQLRRARQSEDIPIILVGNKSDLVRSREVSVEEGRACAVV 219

  Fly   665 RDAKFIETSSGIQHNVDELLVGILKQMRLKEKREKKATASKMKTSRTHISL-HLAKELLQKIC-- 726
            .|.||||||:.:.|||.:|..||::|:||: |..|:..|.:|.:|:...|: ..||..|.||.  
 Frog   220 FDCKFIETSASLHHNVKDLFEGIVRQIRLR-KDSKEDNARRMASSKRRESIGKKAKRFLGKIVAK 283

  Fly   727 ----LSDISKSKSCENLHVL 742
                ::...|||||.:|.||
 Frog   284 NNKKMAFKQKSKSCHDLSVL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk2NP_001286577.1 RGK 527..742 CDD:206715 83/229 (36%)
small_GTPase 527..694 CDD:197466 65/174 (37%)
rradNP_001016726.1 RGK 87..303 CDD:206715 83/229 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5084
SonicParanoid 1 1.000 - - X743
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.