DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk2 and REM1

DIOPT Version :9

Sequence 1:NP_001286577.1 Gene:Rgk2 / 37132 FlyBaseID:FBgn0085419 Length:742 Species:Drosophila melanogaster
Sequence 2:XP_005260461.1 Gene:REM1 / 28954 HGNCID:15922 Length:306 Species:Homo sapiens


Alignment Length:289 Identity:104/289 - (35%)
Similarity:149/289 - (51%) Gaps:41/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   479 TSVNSTNSRASERSPFEGSCCGAGYANVDSLPATPDD--SENLDPPP--PARYRVVMLGDAGVGK 539
            ::|.||.|    :.|..|.............|| |||  ||:.|...  .|.||||:|||.||||
Human    34 STVPSTQS----QHPRLGQSASLNPPTQKPSPA-PDDWSSESSDSEGSWEALYRVVLLGDPGVGK 93

  Fly   540 TALVNQFMTSEYMHTY----DASL--VLDDEFGEKTVSVLLDDEESDMVFIDHPSVE-----MSV 593
            |:|.:.|...:....:    |.:|  |.:|.: |:|::|  |.|::.:|.:|....|     .|.
Human    94 TSLASLFAGKQERDLHEQLGDPALPSVAEDVY-ERTLTV--DGEDTTLVVVDTWEAEKLDKSWSQ 155

  Fly   594 ENSL---STYEPHGCVVVFSVVDRSSFRVAEEIINYLWQENYTKDKAVILVGNKADLARARLITS 655
            |:.|   |.|     |:|:|:.||.||..|.|:...|.:.:......:|||||||||||.|.::.
Human   156 ESCLQGGSAY-----VIVYSIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSV 215

  Fly   656 QEGKALAASRDAKFIETSSGIQHNVDELLVGILKQMRLKEKREKKATASKMKTSRTHISL-HLAK 719
            :||:|.|...|.||||||:.:||||.||..|:::|:||   |.:.:.|.:....|...|| ..|:
Human   216 EEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRL---RRRDSAAKEPPAPRRPASLAQRAR 277

  Fly   720 ELLQKICLSDI------SKSKSCENLHVL 742
            ..|.::.....      ::||||.||.||
Human   278 RFLARLTARSARRRALKARSKSCHNLAVL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk2NP_001286577.1 RGK 527..742 CDD:206715 87/235 (37%)
small_GTPase 527..694 CDD:197466 73/180 (41%)
REM1XP_005260461.1 RGK 81..306 CDD:206715 87/235 (37%)
small_GTPase 81..245 CDD:197466 70/171 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H7514
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5084
SonicParanoid 1 1.000 - - X743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.