DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk2 and GEM

DIOPT Version :9

Sequence 1:NP_001286577.1 Gene:Rgk2 / 37132 FlyBaseID:FBgn0085419 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_005252.1 Gene:GEM / 2669 HGNCID:4234 Length:296 Species:Homo sapiens


Alignment Length:275 Identity:95/275 - (34%)
Similarity:142/275 - (51%) Gaps:53/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 YANVDSLPATPDD-------SENLDPPPPAR-----YRVVMLGDAGVGKTALVNQF------MTS 549
            |::.:...|||:|       |::.|....:.     ||||::|:.||||:.|.|.|      |.|
Human    40 YSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDS 104

  Fly   550 EY----MHTYDASLVLDDEFGEKTVSVLLD--DEESDMVFI-DHPSVEMSVENSLSTYEPHGCVV 607
            :.    ..||:.:|::|   ||....:|||  :.:.:..:: ||.   |.|.::.        ::
Human   105 DCEVLGEDTYERTLMVD---GESATIILLDMWENKGENEWLHDHC---MQVGDAY--------LI 155

  Fly   608 VFSVVDRSSFRVAEEIINYLWQENYTKDKAVILVGNKADLARARLITSQEGKALAASRDAKFIET 672
            |:|:.||:||..|.|:...|.:...|:|..:||||||:||.|.|.::..||:|.|...|.|||||
Human   156 VYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIET 220

  Fly   673 SSGIQHNVDELLVGILKQMRL----KEKREKKATASKMKTSRTHISLHLAKELLQKICLSDIS-- 731
            |:.:||||.||..||::|:||    |||.|::....|.|.|..    ..|:....||...:..  
Human   221 SAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMP----RKARRFWGKIVAKNNKNM 281

  Fly   732 ----KSKSCENLHVL 742
                |||||.:|.||
Human   282 AFKLKSKSCHDLSVL 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk2NP_001286577.1 RGK 527..742 CDD:206715 86/237 (36%)
small_GTPase 527..694 CDD:197466 70/183 (38%)
GEMNP_005252.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 7/27 (26%)
RGK 76..296 CDD:206715 86/237 (36%)
Calmodulin-binding. /evidence=ECO:0000250 266..285 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.