DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk2 and Gem

DIOPT Version :9

Sequence 1:NP_001286577.1 Gene:Rgk2 / 37132 FlyBaseID:FBgn0085419 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_034406.2 Gene:Gem / 14579 MGIID:99844 Length:295 Species:Mus musculus


Alignment Length:316 Identity:102/316 - (32%)
Similarity:148/316 - (46%) Gaps:75/316 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 RHFSISKG----NVVNCGDSIISRRSRSNTSVNSTNSRASERSPFEGSCCGAGYANVDSLPATPD 514
            ||..:.|.    |:.|...:......|.:.|.:||:|..|..|       |..|           
Mouse    28 RHLMVQKDPHPCNLRNRHSTAPEEHCRRSWSSDSTDSVISSES-------GNTY----------- 74

  Fly   515 DSENLDPPPPARYRVVMLGDAGVGKTALVNQF------MTSEY----MHTYDASLVLDDEFGEKT 569
                        ||||::|:.||||:.|.|.|      |.|:.    ..||:.:||:|   ||..
Mouse    75 ------------YRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLVVD---GESA 124

  Fly   570 VSVLLD--DEESDMVFI-DHPSVEMSVENSLSTYEPHGCVVVFSVVDRSSFRVAEEIINYLWQEN 631
            ..:|||  :.:.:..:: ||.   |.|.::.        ::|:|:.||:||..|.|:...|.:..
Mouse   125 TIILLDMWENKGENEWLHDHC---MQVGDAY--------LIVYSITDRASFEKASELRIQLRRAR 178

  Fly   632 YTKDKAVILVGNKADLARARLITSQEGKALAASRDAKFIETSSGIQHNVDELLVGILKQMRL--- 693
            .|:|..:||||||:||.|.|.::..||:|.|...|.||||||:.:||||.||..||::|:||   
Mouse   179 QTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRD 243

  Fly   694 -KEKREKKATASKMKTSRTHISLHLAKELLQKICLSDIS------KSKSCENLHVL 742
             |||.|::....|.:.|..    ..|:....||...:..      |||||.:|.||
Mouse   244 SKEKNERRLAYQKRRESIP----RKARRFWGKIVAKNNKNMAFKLKSKSCHDLSVL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk2NP_001286577.1 RGK 527..742 CDD:206715 86/237 (36%)
small_GTPase 527..694 CDD:197466 71/183 (39%)
GemNP_034406.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..64 6/24 (25%)
RGK 75..295 CDD:206715 86/237 (36%)
small_GTPase 75..241 CDD:197466 70/179 (39%)
Calmodulin-binding 265..284 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8675
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.