powered by:
Protein Alignment GstE11 and CAM1
DIOPT Version :9
Sequence 1: | NP_001286575.1 |
Gene: | GstE11 / 37128 |
FlyBaseID: | FBgn0034354 |
Length: | 225 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_015277.1 |
Gene: | CAM1 / 856059 |
SGDID: | S000005969 |
Length: | 415 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 66 |
Identity: | 19/66 - (28%) |
Similarity: | 31/66 - (46%) |
Gaps: | 4/66 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 137 LQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVST---AEAFAPIEPDQFPRLVQWVKRIQALP 198
:.|..|..|:.|....||..:.:::||| ..||:.| ...|......|.|.:|:|...::|.|
Yeast 136 VDKIVDIFENRLKNYTYLATENISLADL-VAASIFTRYFESLFGTEWRAQHPAIVRWFNTVRASP 199
Fly 199 Y 199
:
Yeast 200 F 200
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157345101 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0625 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.740 |
|
Return to query results.
Submit another query.