DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GTT1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:215 Identity:50/215 - (23%)
Similarity:90/215 - (41%) Gaps:50/215 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LELDLRLVNVK--AGEHKSAEFLKLNAQHTIPVLD--DNGT----IVSDSHIICSYLADKYAPEG 84
            |.|:..:|..|  |......|..|::.....|:|:  |..|    |:::|..|..|:...:    
Yeast    26 LNLEYEIVPYKRDANFRAPPELKKIHPLGRSPLLEVQDRETGKKKILAESGFIFQYVLQHF---- 86

  Fly    85 DDS--LYPKDPEKRRLVDARLYYDCGHLFP--RIRFIVE---------PVIY------------F 124
            |.|  |..:|.:....::..|:|..|.|.|  .|.||:.         |:.|            :
Yeast    87 DHSHVLMSEDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARKVADKISQAY 151

  Fly   125 GAGEVPSDRVAYLQKAYDGLEHCLAEGD-YLVGDKLTIAD--LSCIASVSTAEAFAPIEPDQFPR 186
            .:|||        :..:|.:|..:::.: |||..||:.||  :|....::....||  .|:.:|.
Yeast   152 SSGEV--------KNQFDFVEGEISKNNGYLVDGKLSGADILMSFPLQMAFERKFA--APEDYPA 206

  Fly   187 LVQWVKRIQALPYYQKNNQE 206
            :.:|:|.|.:...|..:.::
Yeast   207 ISKWLKTITSEESYAASKEK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 49/205 (24%)
GST_N_Delta_Epsilon 5..78 CDD:239343 15/57 (26%)
GST_C_Delta_Epsilon 94..211 CDD:198287 31/139 (22%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 15/64 (23%)
GST_C_GTT1_like 93..218 CDD:198298 31/134 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.