DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and YGR201C

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:55/208 - (26%)
Similarity:78/208 - (37%) Gaps:49/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RAVLLTAAALGLELDLRLVNVKAGEHKSAEFL-----KLNAQHTIPVLDDNGTIVSDSHIICSYL 76
            |.::.|....||...|:| :||..:...|:.|     .|....|.....|..|: :::..|..||
Yeast    13 RKLIRTIVPRGLVRSLKL-DVKLADPSDAQQLYEREFPLRKYPTFVGPHDEWTL-TEAMAIDYYL 75

  Fly    77 ----ADKYA------PEGD----------DSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPV 121
                :||.|      ||||          :||...|         .|...|...||.|.  |:| 
Yeast    76 IHLSSDKEAVRQLLGPEGDFKTRADILRWESLSNSD---------FLNEVCEVFFPLIG--VKP- 128

  Fly   122 IYFGAGEVPSDR--VAYLQKAYDGLEHCLAEGDYLV-GDKLTIADLSCIASVSTA--EAFAPIEP 181
              :.|.|..:.|  |..:...|   |..|.:..||| .|..|:|||...|:.|..  ..|.....
Yeast   129 --YNATEFKAARENVDTIVSLY---EKRLKKQQYLVCDDHETLADLISAAAFSLGFISFFDETWR 188

  Fly   182 DQFPRLVQWVKRI 194
            .:.|.:.:|..|:
Yeast   189 SKHPEVTRWFNRV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 55/208 (26%)
GST_N_Delta_Epsilon 5..78 CDD:239343 17/69 (25%)
GST_C_Delta_Epsilon 94..211 CDD:198287 28/106 (26%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 17/66 (26%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 31/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345088
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.