DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GTT2

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:62/222 - (27%)
Similarity:103/222 - (46%) Gaps:32/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAKPILYYAPRSP-PCRA-VLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLD-DN 62
            |..|.|:|..|..| |.|. :.|....:...:....:|:..||||..|||..|...|:|||: |:
Yeast    15 MKQKMIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDD 79

  Fly    63 GTIVSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLF-PRIRF-IVEPV-IYF 124
            ||::::...|..|:.   |.:|..:|..|.|.::.::         |:. .|... :::|| :||
Yeast    80 GTLIAECTAITEYID---ALDGTPTLTGKTPLEKGVI---------HMMNKRAELELLDPVSVYF 132

  Fly   125 -----GAG---EVPSDR---VAYLQKAYDGLEH---CLAEGDYLVGDKLTIADLSCIASVSTAEA 175
                 |.|   |:..::   :....||..|:.:   .|.|..|:.||..::||::.||.:..|..
Yeast   133 HHATPGLGPEVELYQNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLIFAAI 197

  Fly   176 FAPIEPDQFPRLVQWVKRIQALPYYQK 202
            .....|::...|..|.||:|..|..:|
Yeast   198 VKLQVPEECEALRAWYKRMQQRPSVKK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 58/212 (27%)
GST_N_Delta_Epsilon 5..78 CDD:239343 25/75 (33%)
GST_C_Delta_Epsilon 94..211 CDD:198287 30/126 (24%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 25/74 (34%)
GST_C_GTT2_like 106..222 CDD:198291 30/124 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345153
Domainoid 1 1.000 43 1.000 Domainoid score I3172
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1708
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.