DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GSTF7

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:208 Identity:56/208 - (26%)
Similarity:86/208 - (41%) Gaps:26/208 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHIICSY 75
            |.|...|.||:......|:.:...:.:|.||||...|:..|....:|..:|....:.:|..|..|
plant    10 PASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKLFESRAITQY 74

  Fly    76 LADKYAPEGDD--SLYPKDPEKRRLVDARLYYDC-GHLFPRI--RFIVEPVI--YFGA---GEVP 130
            :|..|:.:|:.  ||..||     :....:..:. .|.|..:  :.:.|.|:  .:|.   ..|.
plant    75 IAHFYSDKGNQLVSLGSKD-----IAGIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTDKTVV 134

  Fly   131 SDRVAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVS------TAEAFAPIEPDQFPRLVQ 189
            .:..|.|.|..|..||.|.|..||..||.|:.||..|..:.      |.:.|     |:.|.:..
plant   135 EEEEAKLAKVLDVYEHRLGESKYLASDKFTLVDLHTIPVIQYLLGTPTKKLF-----DERPHVSA 194

  Fly   190 WVKRIQALPYYQK 202
            ||..|.:.|..:|
plant   195 WVADITSRPSAKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 54/202 (27%)
GST_N_Delta_Epsilon 5..78 CDD:239343 18/66 (27%)
GST_C_Delta_Epsilon 94..211 CDD:198287 31/123 (25%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351 18/66 (27%)
GST_C_Phi 95..209 CDD:198296 31/118 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.