DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GSTF4

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:197 Identity:47/197 - (23%)
Similarity:80/197 - (40%) Gaps:19/197 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHIICSY 75
            |.|...|.||.......|..:...|.::.||||:..||.||....:||.:|....:.:|..|..|
plant    43 PFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRAITQY 107

  Fly    76 LADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLF--PRIRFIVEPVI--YFGA---GEVPSDR 133
            :|..::..|...|..:..|....:...:..: .|.|  |..:...|.||  .:|.   ..:..:.
plant   108 IAYVHSSRGTQLLNLRSHETMATLTMWMEIE-AHQFDPPASKLTWEQVIKPIYGLETDQTIVKEN 171

  Fly   134 VAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVS------TAEAFAPIEPDQFPRLVQWVK 192
            .|.|:|..:..|..|.|..:|..:..|:.||..:.::.      |.:.|     ::..::.:||.
plant   172 EAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQYLLGTPTKKLF-----EKRSKVRKWVD 231

  Fly   193 RI 194
            .|
plant   232 EI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 47/197 (24%)
GST_N_Delta_Epsilon 5..78 CDD:239343 21/66 (32%)
GST_C_Delta_Epsilon 94..211 CDD:198287 23/114 (20%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 21/65 (32%)
GST_C_Phi 126..243 CDD:198296 23/114 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.