DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GSTT2

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:209 Identity:52/209 - (24%)
Similarity:93/209 - (44%) Gaps:21/209 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YAPR-SPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHII 72
            ||.| |.|.||||:......::.|..|:::...:..|.||.::|....:|.:.|....:.:||.|
plant     6 YADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLFESHAI 70

  Fly    73 CSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIR-FIVEPVIYFGAG-----EVPS 131
            ..||:..|| ...|..||.|..||..:.:.|.:...:|.|... :::..|:....|     :..:
plant    71 LIYLSSAYA-SVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVLAPALGLPLNPKAAA 134

  Fly   132 DRVAYLQKAYDGLEHCLAEGD--YLVGDKL-TIADLSCIASVSTAEAFAP------IEPDQFPRL 187
            :....|..:...||....:|.  :|:|.|. :|||||.:..:...:....      :.|.:  ::
plant   135 EAENILTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQVLDDKDRLRLLSPHK--KV 197

  Fly   188 VQWVK--RIQALPY 199
            .||::  |...:|:
plant   198 EQWIESTRKATMPH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 51/206 (25%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/69 (32%)
GST_C_Delta_Epsilon 94..211 CDD:198287 24/123 (20%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 22/71 (31%)
GST_C_Theta 92..221 CDD:198292 24/122 (20%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.