DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GSTT3

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:215 Identity:54/215 - (25%)
Similarity:96/215 - (44%) Gaps:27/215 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YAPR-SPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHII 72
            ||.| |.|.||||:......::.|..|:.:...:..|.||..:|....:|.:.|....:|:||.|
plant     6 YADRMSQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIVDGKLKLSESHAI 70

  Fly    73 CSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFP-RIRFIVEPVIYFGAG-----EVPS 131
            ..||:..| |...|..||.|..||..:.:.|.:...:|.| ...:::..|:....|     :..:
plant    71 LIYLSSAY-PSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVLGPALGLPLNPKAAA 134

  Fly   132 DRVAYLQKAYDGLEHCLAEGD--YLVG-DKLTIADLSCIASVSTAEAFAPIEPDQFPRL------ 187
            :....|.|:...|:....:|:  :|:| ::.:|||||.:..::..:..     |...||      
plant   135 EAEQLLTKSLTTLDTFWLKGNAMFLLGSNQPSIADLSLVCELTQLQVL-----DDKDRLRLLSPH 194

  Fly   188 ---VQWVK--RIQALPYYQK 202
               .||::  |...:|::.:
plant   195 KNVEQWIENTRKATMPHFDE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 53/209 (25%)
GST_N_Delta_Epsilon 5..78 CDD:239343 23/69 (33%)
GST_C_Delta_Epsilon 94..211 CDD:198287 25/129 (19%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 52/201 (26%)
GST_N_Theta 3..78 CDD:239348 23/71 (32%)
GST_C_Theta 92..221 CDD:198292 25/128 (20%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.