DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GSTT1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:242 Identity:54/242 - (22%)
Similarity:104/242 - (42%) Gaps:43/242 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YAPR-SPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHII 72
            ||.| |.|.|||::.....|::.|..|:::...:..|.||..:|....:|.:.|....:.:||.|
plant     7 YADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKLFESHAI 71

  Fly    73 CSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGH---------------LFPRIRFIVEPVI 122
            ..||:..: |...|..||.|..||..:.:.|  |..|               |.|.:...:.|  
plant    72 LIYLSSAF-PSVADHWYPNDLSKRAKIHSVL--DWHHTNLRRGAAGYVLNSVLGPALGLPLNP-- 131

  Fly   123 YFGAGEVPSDRVAYLQKAYDGLEHCLAEGD--YLVG-DKLTIADLSCIASVSTAEAFAPIEPDQF 184
                 :..::....|.|:...||....:|:  :|:| ::.:|||||.:..:...:...  :.|:.
plant   132 -----KAAAEAEQLLTKSLSTLETFWLKGNAKFLLGSNQPSIADLSLVCELMQLQVLD--DKDRL 189

  Fly   185 ------PRLVQWVKRIQ--ALPYYQKNNQEGLDMLVGLVKGLLAERQ 223
                  .::.||::..:  .:|::.:.:    ::|..:.:|....|:
plant   190 RLLSTHKKVEQWIENTKKATMPHFDETH----EILFKVKEGFQKRRE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 50/215 (23%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/69 (32%)
GST_C_Delta_Epsilon 94..211 CDD:198287 24/142 (17%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 22/71 (31%)
GST_C_Theta 93..223 CDD:198292 25/144 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.