DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GSTF2

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:221 Identity:56/221 - (25%)
Similarity:87/221 - (39%) Gaps:49/221 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHIICSY 75
            |.|...|.||:......|:.:|..|.:|.||||...||..|....:|..:|....:.:|..|..|
plant    10 PASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQY 74

  Fly    76 LADKYAPEGDDSL---------------------YPKDPEKRRLVDARLYYDCGHLFPRIRFIV- 118
            :|.:|..:|.:.|                     :..||     |.::|.::  .:|..|..:. 
plant    75 IAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDP-----VASKLAFE--QIFKSIYGLTT 132

  Fly   119 -EPVIYFGAGEVPSDRVAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVS------TAEAF 176
             |.|:        ::..|.|.|..|..|..|.|..||.|:..|:.||..|.::.      |.:.|
plant   133 DEAVV--------AEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLF 189

  Fly   177 APIEPDQFPRLVQWVKRIQALPYYQK 202
            .     :.||:.:||..|...|..:|
plant   190 T-----ERPRVNEWVAEITKRPASEK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 54/215 (25%)
GST_N_Delta_Epsilon 5..78 CDD:239343 21/66 (32%)
GST_C_Delta_Epsilon 94..211 CDD:198287 29/117 (25%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 22/67 (33%)
GST_C_Phi 96..211 CDD:198296 31/135 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.