DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:163 Identity:49/163 - (30%)
Similarity:74/163 - (45%) Gaps:7/163 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YAPRSPPCRA-VLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHII 72
            |......|.| |||.......|.:|..||:.|..||...||.:|....:|.|.|:...:.:|..|
plant     6 YGDEMSACVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFESRAI 70

  Fly    73 CSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFG-AGEVPS----- 131
            .:|:|:|:..:|.|....:||::..:|......:..|..|.|..::..:|... .||.|:     
plant    71 TAYIAEKHRDKGTDLTRHEDPKEAAIVKLWSEVEAHHFNPAISAVIHQLIVVPLQGESPNAAIVE 135

  Fly   132 DRVAYLQKAYDGLEHCLAEGDYLVGDKLTIADL 164
            :.:..|.|..|..|..|.:..||.||..|:|||
plant   136 ENLENLGKILDVYEERLGKTKYLAGDTYTLADL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 49/163 (30%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/69 (32%)
GST_C_Delta_Epsilon 94..211 CDD:198287 21/77 (27%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 49/163 (30%)
GST_N_Phi 2..77 CDD:239351 23/70 (33%)
GST_C_Phi 92..208 CDD:198296 21/77 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.