DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GSTF11

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:203 Identity:52/203 - (25%)
Similarity:84/203 - (41%) Gaps:31/203 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHIICSYLADKYAPE 83
            |||......:|.::..|::...|.|..:.|.......:|.::|....:.:|..|..|.|.|||.:
plant    17 VLLCFLEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFESRAIARYYATKYADQ 81

  Fly    84 GDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDRVAYLQ-------KAY 141
            |.| |..|..|.|.:||..:..:..:.:.....:|..|::......|.| ||.::       |..
plant    82 GTD-LLGKTLEGRAIVDQWVEVENNYFYAVALPLVMNVVFKPKSGKPCD-VALVEELKVKFDKVL 144

  Fly   142 DGLEHCLAEGDYLVGDKLTIADLS------------CIASVSTAEAFAPIEPDQFPRLVQWVKRI 194
            |..|:.||...||.||:.|:||||            .::.:.|:.          ..|.:|...|
plant   145 DVYENRLATNRYLGGDEFTLADLSHMPGMRYIMNETSLSGLVTSR----------ENLNRWWNEI 199

  Fly   195 QALPYYQK 202
            .|.|.::|
plant   200 SARPAWKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 50/197 (25%)
GST_N_Delta_Epsilon 5..78 CDD:239343 13/58 (22%)
GST_C_Delta_Epsilon 94..211 CDD:198287 31/128 (24%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 52/203 (26%)
GST_N_Phi 2..77 CDD:239351 14/59 (24%)
GST_C_Phi 91..209 CDD:198296 31/128 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.