DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GSTF8

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001323480.1 Gene:GSTF8 / 819386 AraportID:AT2G47730 Length:263 Species:Arabidopsis thaliana


Alignment Length:205 Identity:57/205 - (27%)
Similarity:94/205 - (45%) Gaps:19/205 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHIICSY 75
            |.|.....||.|.....|:.:|..|:::||.||....|.||....||.|:|....:.:|..|..|
plant    58 PMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGDLTLFESRAITQY 122

  Fly    76 LADKYAPEGDDSLYPKDPEK-RRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDRVAY--- 136
            ||::|:.:| :.|..:|.:| :...:..|..:.....|....:....::.|...:.:|..|.   
plant   123 LAEEYSEKG-EKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVFKGMFGMTTDPAAVQEL 186

  Fly   137 ---LQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASV------STAEAFAPIEPDQFPRLVQWVK 192
               |||..|..|..||:.::|.||..|:|||..:.::      .:...|     |..|::.:|:|
plant   187 EGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKVLF-----DSRPKVSEWIK 246

  Fly   193 RIQALPYYQK 202
            :|.|.|.:.|
plant   247 KISARPAWAK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 55/199 (28%)
GST_N_Delta_Epsilon 5..78 CDD:239343 23/66 (35%)
GST_C_Delta_Epsilon 94..211 CDD:198287 29/122 (24%)
GSTF8NP_001323480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.