DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GSTF9

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 / 817636 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana


Alignment Length:163 Identity:43/163 - (26%)
Similarity:71/163 - (43%) Gaps:7/163 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHIIC 73
            |.|.....:..|:|....|:..:...|::..||||...:|.|....|:|.:.|....:.:|..:.
plant     6 YGPHFASPKRALVTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFESRAVM 70

  Fly    74 SYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDRVAY-- 136
            .|:|:||..:|.| |..|..|.|..|:..|..:.....|.:..:...:::......|||....  
plant    71 RYVAEKYRSQGPD-LLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFASVMGFPSDEKLIKE 134

  Fly   137 ----LQKAYDGLEHCLAEGDYLVGDKLTIADLS 165
                |....|..|..|::..||.||.:::|||:
plant   135 SEEKLAGVLDVYEAHLSKSKYLAGDFVSLADLA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 43/163 (26%)
GST_N_Delta_Epsilon 5..78 CDD:239343 17/68 (25%)
GST_C_Delta_Epsilon 94..211 CDD:198287 19/78 (24%)
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 43/163 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.