DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GDAP1L1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:243 Identity:53/243 - (21%)
Similarity:84/243 - (34%) Gaps:65/243 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSH 70
            :||:..:|...:.|.|..|..||..:.|.|::...|||...|::||....:||:.....|:||..
Human    48 VLYHWTQSFSSQKVRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYD 112

  Fly    71 IICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDRVA 135
            .|..|:...:...|...                   |...||     .:|:      .||::.|.
Human   113 QIIDYVERTFTGGGRGR-------------------CPSGFP-----AQPL------AVPTEHVV 147

  Fly   136 YLQKAYDGLEHCLAEG-----DYLVGDKLT--------IADLSCIASVSTAEA----------FA 177
            .|......|:|.....     |.|..|..|        :...|.|...:|||.          ..
Human   148 ALMPEVGSLQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANATTDLM 212

  Fly   178 PIEPDQFPRLVQWVKRIQALPYYQKNNQEGLDML----VGLVKGLLAE 221
            .::.::.|:|.:        ||..|..:....:|    |..:|.:|.|
Human   213 KLDHEEEPQLSE--------PYLSKQKKLMAKILEHDDVSYLKKILGE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 45/214 (21%)
GST_N_Delta_Epsilon 5..78 CDD:239343 23/71 (32%)
GST_C_Delta_Epsilon 94..211 CDD:198287 24/139 (17%)
GDAP1L1NP_001243666.1 GstA 47..333 CDD:223698 53/243 (22%)
GST_N_GDAP1 47..119 CDD:239350 23/70 (33%)
GST_C_GDAP1L1 220..330 CDD:198335 10/41 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.