DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and Eef1e1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_079656.1 Gene:Eef1e1 / 66143 MGIID:1913393 Length:174 Species:Mus musculus


Alignment Length:183 Identity:42/183 - (22%)
Similarity:68/183 - (37%) Gaps:38/183 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLD-DNGTIVSDSHIICSYLADKYAPEGDD 86
            |||..|.|..:.:.:|.|...||:     .:..||||. :||..:.....|.::|..:.:.|   
Mouse     2 AAAAELRLLEKSLGLKPGNKYSAQ-----GERQIPVLQTNNGPSLMGLSTIATHLVKQASKE--- 58

  Fly    87 SLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDRVAYLQKAYDGLEHCLAEG 151
            .|.....|::.:|...|           .|.|..|    .|....:....|.|   .|...|.:.
Mouse    59 HLLGSTAEEKAMVQQWL-----------EFRVTRV----DGHSSKEDTQTLLK---DLNSYLEDK 105

  Fly   152 DYLVGDKLTIADLSCIASVS------TAEAFAPIEPDQFPRLVQWVKRIQALP 198
            .||.|..:|:||:.....:.      |.:     |.:::..:.:|...||..|
Mouse   106 VYLAGHNITLADILLYYGLHRFIVDLTVQ-----EKEKYLNVSRWFCHIQHYP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 41/181 (23%)
GST_N_Delta_Epsilon 5..78 CDD:239343 17/55 (31%)
GST_C_Delta_Epsilon 94..211 CDD:198287 23/111 (21%)
Eef1e1NP_079656.1 N-terminal. /evidence=ECO:0000250 2..56 17/58 (29%)
Linker. /evidence=ECO:0000250 57..63 2/8 (25%)
C-terminal. /evidence=ECO:0000250 64..152 22/110 (20%)
GST_C_AIMP3 65..165 CDD:198338 23/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.