DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GstD10

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:201 Identity:72/201 - (35%)
Similarity:118/201 - (58%) Gaps:10/201 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYYAPRSPPCRAVLLTAAALGLELDLR-LVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSH 70
            |||.|.|.|||:||:||.|||:|.|.: ::|.:|.|..:.|:||:|.|||||.|.|:|..:.:|.
  Fly     3 LYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESR 67

  Fly    71 IICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDRVA 135
            .|..||.:||..  ||.|:|||.:|:.|::.|||:|.|.|:........|.|:.   :.|::...
  Fly    68 AIMVYLVEKYGK--DDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFL---KKPANEEN 127

  Fly   136 Y--LQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQAL- 197
            |  ::.|::.|...|....|..|...::||::.:|:|||.:. |..:..::..:.:|.:..:.| 
  Fly   128 YKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDV-AGFDFKRYANVARWYENAKKLT 191

  Fly   198 PYYQKN 203
            |.:::|
  Fly   192 PGWEEN 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 70/194 (36%)
GST_N_Delta_Epsilon 5..78 CDD:239343 36/71 (51%)
GST_C_Delta_Epsilon 94..211 CDD:198287 28/113 (25%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 36/71 (51%)
PLN02473 3..196 CDD:166114 71/198 (36%)
GST_C_Delta_Epsilon 89..205 CDD:198287 28/113 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460287
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.