DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and eef1e1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001373479.1 Gene:eef1e1 / 565440 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio


Alignment Length:163 Identity:34/163 - (20%)
Similarity:56/163 - (34%) Gaps:60/163 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IPVLDDN------GTIVSDSHIICSYLADKYAPE--GDDSLYPKDPEKRRLVDARLYY------D 106
            :|||.:|      |.:.    |.|..:.:...||  |||:      |:|.:|...|.:      :
Zfish    29 VPVLQNNNGPALTGLVT----IACHLVKEAKRPELLGDDA------EQRAVVQQWLEHRITKLDN 83

  Fly   107 CGHLFPRI------RFIVEPVIYFGAGEVPSDRVAYLQKAYDGLEHCLAEGDYLVGDKLTIADLS 165
            |.....::      |::.:.|...|.....:|.:.|.     |:.|.:.|        |.|.:..
Zfish    84 CSKEEVKVILKDLNRYLEDKVYLAGNVFTLADILMYY-----GIHHIIVE--------LAIQEKE 135

  Fly   166 CIASVSTAEAFAPIEPDQFPRLVQWVKRIQALP 198
            |..:||                 :|...||..|
Zfish   136 CYLNVS-----------------RWFDHIQHYP 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 33/161 (20%)
GST_N_Delta_Epsilon 5..78 CDD:239343 7/27 (26%)
GST_C_Delta_Epsilon 94..211 CDD:198287 22/117 (19%)
eef1e1NP_001373479.1 GST_C_AIMP3 64..161 CDD:198338 22/124 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.