DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and gstr

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr / 564619 ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio


Alignment Length:251 Identity:57/251 - (22%)
Similarity:104/251 - (41%) Gaps:58/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAKPILYYAPRSPPCRAVLLTAAALGLE-LDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGT 64
            |:...:||:...||||..:::......|: ...:|::....||:|.|...||.:..:|.......
Zfish     1 MAQNMLLYWGTGSPPCWRLMIALEEKQLQGYKHKLLSFDKKEHQSPEVKALNPRAQLPTFKHGEI 65

  Fly    65 IVSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARL--------------YYDCGHLFP--- 112
            :|::|...|.||...:..:| ..|.|.:|.:..||..|:              :||  .|.|   
Zfish    66 VVNESFAACLYLESVFKSQG-TRLIPDNPAEMALVYQRMFETENLQQKMYEVAFYD--WLVPEGE 127

  Fly   113 ---------RIRFIVEPVIYFGAGEVPSDRVAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIA 168
                     :.:.|.|..::.|          ||:|        :.:|.||.|...::||:.|..
Zfish   128 RLESALKRNKEKLIEELKLWEG----------YLEK--------MGKGSYLAGKNFSMADVVCFP 174

  Fly   169 SVSTAEAFAP---IEPDQFPRLVQWVKRIQALPYYQKN-NQEGLDMLVG--LVKGL 218
            .:    |:.|   ...::.|||:::.:.::..|..:.: ..|.|:..||  ::|.|
Zfish   175 VI----AYFPRLQCPKERCPRLMEYYEMVKDRPSIKASWPPEWLEKPVGEDILKSL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 49/222 (22%)
GST_N_Delta_Epsilon 5..78 CDD:239343 20/73 (27%)
GST_C_Delta_Epsilon 94..211 CDD:198287 28/146 (19%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 50/226 (22%)
GST_N_family 5..78 CDD:238319 19/72 (26%)
GST_C_family 99..199 CDD:198286 24/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589761
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.