DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and gstt1a

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001314691.1 Gene:gstt1a / 563972 ZFINID:ZDB-GENE-031001-13 Length:242 Species:Danio rerio


Alignment Length:210 Identity:58/210 - (27%)
Similarity:93/210 - (44%) Gaps:36/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHI 71
            ||....|.|||:|.:.|....:..:.:.|::.|||....||.|::....:|.|.|...::::|..
Zfish     5 LYLDLHSQPCRSVFIFAKINKIPFEYKAVDLSAGEQYGDEFGKVSIIRKVPALKDGDFLLTESIA 69

  Fly    72 ICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYF--------GAGE 128
            |..|||.|::.  .|..||.|.:||..||..|.:.    ...||.....|.:|        || .
Zfish    70 ILLYLAGKHST--PDHWYPADLQKRAQVDEFLSWQ----HTNIRSHGSKVFWFKGVLPAVTGA-P 127

  Fly   129 VPSDRVAYLQKAYDGL--------EHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEP--DQ 183
            ||.::   :..|.:.|        :..|....:::|||:::||:     |:..|...|:..  |.
Zfish   128 VPKEK---MDSALEDLNMSLKIFEDKFLQSRPFIIGDKISLADI-----VAIVEMMQPVATGVDV 184

  Fly   184 F---PRLVQWVKRIQ 195
            |   |.|..|..|::
Zfish   185 FEGRPALSAWRDRVK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 58/210 (28%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/70 (31%)
GST_C_Delta_Epsilon 94..211 CDD:198287 30/123 (24%)
gstt1aNP_001314691.1 GstA 3..199 CDD:223698 58/208 (28%)
GST_N_Theta 3..78 CDD:239348 23/72 (32%)
GST_C_Theta 91..217 CDD:198292 30/122 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.