DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and gdap1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:246 Identity:57/246 - (23%)
Similarity:85/246 - (34%) Gaps:99/246 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAKPILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIV 66
            ::|.|||:..:|...:.|.|..|..||:.:...|::...||....|::||....:|||      |
Zfish    37 ASKLILYHWTQSFSSQKVRLAIAEKGLQCEDYDVSLPLSEHNEPWFMRLNPTGEVPVL------V 95

  Fly    67 SDSHIIC------SYL--------ADKYAPEGDDSLYPKDPEKRRLVDARLYYD-----CGHLFP 112
            .|:|:||      .||        ..|..||...:.|.:....|.|:|: |..|     |     
Zfish    96 HDNHVICDPTQIMDYLEQNFCDEQTPKLIPEEGSTYYHRVQHYRELLDS-LQMDAYTHGC----- 154

  Fly   113 RIRFIVEPVIYFGAGEVPS---------------------------------------------D 132
                |:.|.|...: .:|:                                             |
Zfish   155 ----ILHPEITVDS-HIPAYATTHIRTQIGNTESELKKLAVENPDLKDAYIAKQRRLKSKLFDHD 214

  Fly   133 RVAYLQKAYDGLEHCL---------------AEGD---YLVGDKLTIADLS 165
            .:.||:|..|.||:.|               .||.   :|.||..:|||:|
Zfish   215 NMKYLKKLLDELENVLDQVETELQRRSEETPEEGSQQAWLCGDFFSIADVS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 56/243 (23%)
GST_N_Delta_Epsilon 5..78 CDD:239343 25/86 (29%)
GST_C_Delta_Epsilon 94..211 CDD:198287 27/140 (19%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 56/243 (23%)
GST_N_GDAP1 40..112 CDD:239350 24/77 (31%)
GST_C_family 193..304 CDD:295467 17/73 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589748
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.