Sequence 1: | NP_001286575.1 | Gene: | GstE11 / 37128 | FlyBaseID: | FBgn0034354 | Length: | 225 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018511.1 | Gene: | gdap1 / 553702 | ZFINID: | ZDB-GENE-050522-424 | Length: | 362 | Species: | Danio rerio |
Alignment Length: | 246 | Identity: | 57/246 - (23%) |
---|---|---|---|
Similarity: | 85/246 - (34%) | Gaps: | 99/246 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 SAKPILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIV 66
Fly 67 SDSHIIC------SYL--------ADKYAPEGDDSLYPKDPEKRRLVDARLYYD-----CGHLFP 112
Fly 113 RIRFIVEPVIYFGAGEVPS---------------------------------------------D 132
Fly 133 RVAYLQKAYDGLEHCL---------------AEGD---YLVGDKLTIADLS 165 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE11 | NP_001286575.1 | GstA | 5..198 | CDD:223698 | 56/243 (23%) |
GST_N_Delta_Epsilon | 5..78 | CDD:239343 | 25/86 (29%) | ||
GST_C_Delta_Epsilon | 94..211 | CDD:198287 | 27/140 (19%) | ||
gdap1 | NP_001018511.1 | GstA | 40..307 | CDD:223698 | 56/243 (23%) |
GST_N_GDAP1 | 40..112 | CDD:239350 | 24/77 (31%) | ||
GST_C_family | 193..304 | CDD:295467 | 17/73 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589748 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |